PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_36554.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YA
Protein Properties Length: 253aa    MW: 27383.5 Da    PI: 10.172
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_36554.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.87.5e-3397153158
     CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                   dep++VN+KQy++Il+RRq Rakle+++kl +k+rkpylheSRh hA++R+RgsgGrF
  MLOC_36554.1  97 DEPIFVNPKQYNGILRRRQLRAKLEAQNKL-TKNRKPYLHESRHLHAMKRARGSGGRF 153
                   79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.6E-3795156IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.72796156IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.1E-2998153IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.9E-2299121IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.9E-22130153IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MLLPSSSSSY DPKGDSFGKS VDDSMRSTLT FGEKHSVFTS QNTDYGQPMA CISYPFSDSG  60
SGVWAAYGSQ AMFHPLTAGG GSSATARVPL PLELAADEPI FVNPKQYNGI LRRRQLRAKL  120
EAQNKLTKNR KPYLHESRHL HAMKRARGSG GRFLNSKQLQ QQQQSGSACT KAIADGANSL  180
GSTYLRLGSG AAGDRPTSAS KTISSQENNK RVAALAPAFT MIPAAQKDDD FFHHHGHHLS  240
FSGHFGQSSE RYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-2097158263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3683720.0AK368372.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2072N04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570525.11e-129PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
TrEMBLM0VR190.0M0VR19_HORVD; Uncharacterized protein
STRINGMLOC_36554.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132762833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.19e-38nuclear factor Y, subunit A5